LPCAT1 anticorps (Middle Region)

N° du produit ABIN635206

Cet anticorps Lapin Polyclonal détecte spécifiquement LPCAT1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour LPCAT1 anticorps (Middle Region) (ABIN635206)

Antigène: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LPCAT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LPCAT1 anticorps

Épitope: Middle Region

Specificité: LPCAT1 antibody was raised against the middle region of LPCAT1

Purification: Affinity purified

Immunogène: LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LPCAT1 Blocking Peptide, (ABIN5614555), is also available for use as a blocking control in assays to test for specificity of this LPCAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPCAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LPCAT1

Antigène: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Autre désignation: LPCAT1

Sujet: Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.

Poids moléculaire: 59 kDa (MW of target protein)